AntiCov_db

General Data

DataBase Content
Peptide IDPeptide nameSequenceToxicityHemolytic potencyInhibitor IC50UnitTarget organismUniprot id
ASCNP1SARSWW-IMWKTPTLKYFGGFNFSQINon Toxin0.4858%SARS coronavirusP11224
ASCNP2SARSWW-IIATAGWTFGAGAALQIPFAMQMAYNon Toxin0.4939%SARS coronavirusP11224
ASCNP3SARSWW-IIIGYHLMSFPQAAPHGVVFLHVTWNon Toxin0.492μMSARS coronavirusP11224
ASCNP4SARSWW-IVGVFVFNGTSWFITQRNFFSNon Toxin0.492μMSARS coronavirusP11224
ASCNP5SARSWW-VaNEVAKNLNESLIDLQELGKYEQYIKWPWYVWNon Toxin0.4932.55μMSARS coronavirusP11224
ASCNP6SARSWW-VbAACEVAKNLNESLIDLQELGKYEQYIKWNon Toxin0.4942%SARS coronavirusP11224
ASCNP7N46QKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQNon Toxin0.503.97μMSARS coronavirusP59594
ASCNP8N46egQNQSANQFQKEISQINEVLTTTNTSLGKLQDDVNQNNQSLNTLQKENon Toxin0.495.07μMSARS coronavirusP59594
ASCNP9EPL5KKKKYRNIRRPGNon Toxin0.4945μg/mlSARS coronavirusNot found
ASCNP10SR9EK13ISGINASVVNIQEEIKKLNEEAKKLNESLIDLQELNon Toxin0.484nMSARS coronavirusP59594
ASCNP11SR9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.485nMSARS coronavirusP59594
ASCNP12SR9EK1IEEINKKVEEIQKKIEELNKKAEELNKKLEELQKKNon Toxin0.48>100μMSARS coronavirusP59594
ASCNP13peptide 9626TLKPIFKLPLGINITNFRNon Toxin0.4911μMSARS coronavirusP59594
ASCNP14HR2ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.480.34μM(EC50)SARS coronavirusP59594
ASCNP15HR1-aYENQKQIANQFNKAISQIQESLTTTSTANon Toxin0.491.16μM(EC50)SARS coronavirusP59594
ASCNP16GST-removed HR2DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYINon Toxin0.462.15μM(EC50)SARS coronavirusP59594
ASCNP17HR1-bIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNon Toxin0.5036.65μM(EC50)SARS coronavirusP59594
ASCNP18His6-HR1YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVNon ToxinNot determined39.05μM(EC50)SARS coronavirusP59594
ASCNP19K10DLKGKYVQIPNon Toxin0.4879.81μMSARS coronavirusP0C6U8
ASCNP20K20NCVKMLCTHTGTGQAITVTPNon Toxin0.4942.65μMSARS coronavirusP0C6U8
ASCNP21K8PTTCANDPNon Toxin0.4944.52μMSARS coronavirusP0C6U8
ASCNP22P9CANLLLQYGSFCTQLNRALSGIANon Toxin0.5050%SARS coronavirusP59594
ASCNP23P8PSSKRFQPFQQFGRDVSDFTNon Toxin0.4950%SARS coronavirusP59594
ASCNP24P10RNTREVFAQVKQMYKTPTLKYFGNon Toxin0.5343.46μMSARS coronavirusP59594
ASCNP25P6TKFPSVYAWERKKISNCVADNon Toxin0.4940.59μMSARS coronavirusP59594
ASCNP26P5KGIYQTSNFRVVPSGDVVRFNon Toxin0.4952.97μMSARS coronavirusP59594
ASCNP27P2KSNVVRGWVFGSTMNNKSQSNon Toxin0.4852.38μMSARS coronavirusP59594
ASCNP28P4TDAVDCSQNPLAELKCSVKSFNon Toxin0.4959.07μMSARS coronavirusP59594
ASCNP29P1TSSMRGVYYPDEIFRSDTLYLNon Toxin0.4937.97μMSARS coronavirusP59594
ASCNP30P3YKGYQPIDVVRDLPSGFNTLNon Toxin0.4956.05μMSARS coronavirusP59594
ASCNP31P7YNYKYRYLRHGKLRPFERDINon Toxin0.4943.24μMSARS coronavirusP59594
ASCNP32HR2-1VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNon Toxin0.4741.55μMSARS coronavirusP59594
ASCNP33HR2-2QPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQNon Toxin0.4635.62μMSARS coronavirusP59594
ASCNP34HR2-3SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNENon Toxin0.4434.48μMSARS coronavirusP59594
ASCNP35HR2-4LDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNon Toxin0.4738.88μMSARS coronavirusP59594
ASCNP36HR2-5FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESNon Toxin0.4637.47μMSARS coronavirusP59594
ASCNP37HR2-6PDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQNon Toxin0.4736.96μMSARS coronavirusP59594
ASCNP38HR2-7GDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYNon Toxin0.456.66μMSARS coronavirusP59594
ASCNP39HR2-8ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4632.87μMSARS coronavirusP59594
ASCNP40HR2-9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.470.31μMSARS coronavirusP59594
ASCNP41HR2-10ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.480.46μMSARS coronavirusP59594
ASCNP42HR2-11GINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.471.53μMSARS coronavirusP59594
ASCNP43HR2-12INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4733.54μMSARS coronavirusP59594
ASCNP44HR2-13INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYINon Toxin0.488.61μMSARS coronavirusP59594
ASCNP45HR2-14INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.482.38μMSARS coronavirusP59594
ASCNP46HR2-15INASVVNIQKEIDRLNEVAKNLNESLIDLNon Toxin0.481.64μMSARS coronavirusP59594
ASCNP47HR2-16VVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4833.86μMSARS coronavirusP59594
ASCNP48HR2-17VVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.480.14μMSARS coronavirusP59594
ASCNP49HR2-19IQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4731.99μMSARS coronavirusP59594
ASCNP50HR2-20IDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4828.93μMSARS coronavirusP59594
ASCNP51sHR2-1LDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon ToxinNot determined43±6.4μM(EC50)SARS coronavirusP59594
ASCNP52sHR2-2PKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon ToxinNot determined24±2.8μM(EC50)SARS coronavirusP59594
ASCNP53sHR2-3LDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon ToxinNot determined>50μM(EC50)SARS coronavirusP59594
ASCNP54sHR2-4FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon ToxinNot determined>50μM(EC50)SARS coronavirusP59594
ASCNP55sHR2-5TSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon Toxin0.44>50μM(EC50)SARS coronavirusP59594
ASCNP56sHR2-6VDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon Toxin0.45>50μM(EC50)SARS coronavirusP59594
ASCNP57sHR2-7DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon Toxin0.46>50μM(EC50)SARS coronavirusP59594
ASCNP58sHR2-8ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKNon ToxinNot determined17±3.0μM(EC50)SARS coronavirusP59594
ASCNP59sHR2-9ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon ToxinNot determined34±4.0μM(EC50)SARS coronavirusP59594
ASCNP60sHR2-10ELDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDNon ToxinNot determined>50μM(EC50)SARS coronavirusP59594
ASCNP61mHR2DLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKENon Toxin0.48>50μM(EC50)SARS coronavirusP11224
ASCNP62sHR1AYRFNGIQVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITNon ToxinNot determined>50μM(EC50)SARS coronavirusP59594
ASCNP63sHR1cNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITNon Toxin0.49>50μM(EC50)SARS coronavirusP59594
ASCNP64NP-1GVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQNon Toxin0.5017.58μMSARS coronavirusP59594
ASCNP65NP-2LTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGNon Toxin0.5138.05μMSARS coronavirusP59594
ASCNP66NP-3KQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGNon Toxin0.4918.16μMSARS coronavirusP59594
ASCNP67NP-4GRLQSLQTYVTQQLIRAAEIRASANLAATKMSECNon Toxin0.5032.23μMSARS coronavirusP59594
ASCNP68CP-1GINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon Toxin0.4719μmol/lSARS coronavirusP59594
ASCNP69CP-2KEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWNon Toxin0.48NoNASARS coronavirusP59594
ASCNP70MucroporinLFGLIPSLIGGLVSAFKNon Toxin0.677.12μM(EC50)SARS coronavirusB9UIY3
ASCNP71Mucroporin-M1LFRLIKSLIKRLVSAFKNon Toxin0.5211.45μMSARS coronavirusB9UIY3
ASCNP72Mucroporin-S1SLIGGLVSAFKNon Toxin0.6347.23μMSARS coronavirusB9UIY3
ASCNP73Mucroporin-S2VSAFKNon Toxin0.4947.07μMSARS coronavirusB9UIY3
ASCNP74SEQ ID NO:1FKLPLGINITNFRAILTAFSNon Toxin0.51>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP75SEQ ID NO:2PTTFMLKYDENGTITDAVDCNon Toxin0.49112.5±26.3IC90 (μg/ml)SARS coronavirusNot found
ASCNP76SEQ ID NO:3VLYNSTFFSTFKCYGVSATKNon Toxin0.49>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP77SEQ ID NO:4PALNCYWPLNDYGFYTTSGINon Toxin0.48>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP78SEQ ID NO:5RDVSDFTDSVRDPKTSEILDNon Toxin0.49>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP79SEQ ID NO:6YQDVNCTDVSTAIHADQLTPNon Toxin0.48113.0±27.6IC90 (μg/ml)SARS coronavirusNot found
ASCNP80SEQ ID NO:7SNNTIAIPTNFSISITTEVMNon Toxin0.49>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP81SEQ ID NO:8QYGSFCTQLNRALSGIAAEQNon Toxin0.4924.9±6.2IC90 (μg/ml)SARS coronavirusNot found
ASCNP82SEQ ID NO:9GIGVTQNVLYENQKQIANQFNon Toxin0.49>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP83SEQ ID NO:10IQKEIDRLNEVAKNLNESLINon Toxin0.4873.5±15.7IC90 (μg/ml)SARS coronavirusNot found
ASCNP84MHVWW-IVGYFVQDDGEWKFTGSSYYYNon Toxin0.494μMmurine hepatitis virusNot found
ASCNP85HR2LSIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNYNon Toxin0.510.5μMMERS coronavirus Not found
ASCNP86HR2PSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELNon Toxin0.490.97 ± 0.15μMMERS coronavirus Not found
ASCNP87HR2P-M1SLTQINTTLLDLEYEMRSLQQVVKALNESYIDLKELNon Toxin0.500.85 ± 0.08μMMERS coronavirus Not found
ASCNP88HR2P-M2SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKELNon Toxin0.480.55 ± 0.04μMMERS coronavirus Not found
ASCNP89HHVTTTFAPPPPRNon Toxin0.4911μg/mlTGEV-coronavirusNot found
ASCNP90SSVVPSKATWGFANon Toxin0.4915μg/mlTGEV-coronavirusNot found
ASCNP91MelittinGIGAVLKVLTTGLPALISWIKRKRQQNon Toxin0.831.65μMHIV, HSV-1 and HNP-2, Junin virus Not found
ASCNP92UruminIPLRGAFINGRWDSQCHRFSNGAIACANon Toxin0.4437.59μMIAV (H1)Not found
ASCNP93NYADITFXDLLXYYGPNon Toxin0.4923.98μMHIV-1Not found
ASCNP94G1LRSRTKIIRIRHNon Toxin0.4881.63μMHIV-1Not found
ASCNP95G2MPRRRRIRRRQKNon Toxin0.4841.78μMHSV-1Not found
ASCNP96Latarcin 1SMWSGMWRRKLKKLRNALKKKLKGENon Toxin0.5141.02μMDENV-2Not found
ASCNP97Epinecidin 1GFIFHIIKGLFHAGKMIHGLVNon Toxin0.4740.65μMJEVNot found
ASCNP98Cecropin AKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKNon Toxin0.172.95μMHIV, HSV-1 and 2, Junin virusNot found
ASCNP99HBD-2, 3LKKLCKLLKKLCKLAGNon Toxin0.5038.67μMHIV-1, HPV, HIV, vaccinia virus, VZVNot found
ASCNP100Hp1036ILGKIWEGIKSIFNon Toxin0.5034.39μMHSV-1, HCVNot found
ASCNP101Hp1239ILSYLWNGIKSIFNon Toxin0.5521.94μMHSV-1, HCVNot found
ASCNP102IndolicidinILPWKWPWWPWRRNon Toxin0.8329.13μMHIVNot found
ASCNP103caerin 1.10GLLSVLGSVAKHVLPHVVPVIAEKLNon Toxin0.4837.59μMSARS coronavirusNot found
ASCNP104caerin 1.6GLFSVLGAVAKHVLPHVVPVIAEKLNon Toxin0.4836.6μMSARS coronavirusNot found
ASCNP1SARSWW-IMWKTPTLKYFGGFNFSQINon Toxin0.4858%SARS coronavirusP11224
ASCNP2SARSWW-IIATAGWTFGAGAALQIPFAMQMAYNon Toxin0.4939%SARS coronavirusP11224
ASCNP3SARSWW-IIIGYHLMSFPQAAPHGVVFLHVTWNon Toxin0.492μMSARS coronavirusP11224
ASCNP4SARSWW-IVGVFVFNGTSWFITQRNFFSNon Toxin0.492μMSARS coronavirusP11224
ASCNP5SARSWW-VaNEVAKNLNESLIDLQELGKYEQYIKWPWYVWNon Toxin0.4932.55μMSARS coronavirusP11224
ASCNP6SARSWW-VbAACEVAKNLNESLIDLQELGKYEQYIKWNon Toxin0.4942%SARS coronavirusP11224
ASCNP7N46QKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQNon Toxin0.503.97μMSARS coronavirusP59594
ASCNP8N46egQNQSANQFQKEISQINEVLTTTNTSLGKLQDDVNQNNQSLNTLQKENon Toxin0.495.07μMSARS coronavirusP59594
ASCNP9EPL5KKKKYRNIRRPGNon Toxin0.4945μg/mlSARS coronavirusNot found
ASCNP10SR9EK13ISGINASVVNIQEEIKKLNEEAKKLNESLIDLQELNon Toxin0.484nMSARS coronavirusP59594
ASCNP11SR9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.485nMSARS coronavirusP59594
ASCNP12SR9EK1IEEINKKVEEIQKKIEELNKKAEELNKKLEELQKKNon Toxin0.48>100μMSARS coronavirusP59594
ASCNP13peptide 9626TLKPIFKLPLGINITNFRNon Toxin0.4911μMSARS coronavirusP59594
ASCNP14HR2ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.480.34μM(EC50)SARS coronavirusP59594
ASCNP15HR1-aYENQKQIANQFNKAISQIQESLTTTSTANon Toxin0.491.16μM(EC50)SARS coronavirusP59594
ASCNP16GST-removed HR2DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYINon Toxin0.462.15μM(EC50)SARS coronavirusP59594
ASCNP17HR1-bIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNon Toxin0.5036.65μM(EC50)SARS coronavirusP59594
ASCNP18His6-HR1YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVNon ToxinNot determined39.05μM(EC50)SARS coronavirusP59594
ASCNP19K10DLKGKYVQIPNon Toxin0.4879.81μMSARS coronavirusP0C6U8
ASCNP20K20NCVKMLCTHTGTGQAITVTPNon Toxin0.4942.65μMSARS coronavirusP0C6U8
ASCNP21K8PTTCANDPNon Toxin0.4944.52μMSARS coronavirusP0C6U8
ASCNP22P9CANLLLQYGSFCTQLNRALSGIANon Toxin0.5050%SARS coronavirusP59594
ASCNP23P8PSSKRFQPFQQFGRDVSDFTNon Toxin0.4950%SARS coronavirusP59594
ASCNP24P10RNTREVFAQVKQMYKTPTLKYFGNon Toxin0.5343.46μMSARS coronavirusP59594
ASCNP25P6TKFPSVYAWERKKISNCVADNon Toxin0.4940.59μMSARS coronavirusP59594
ASCNP26P5KGIYQTSNFRVVPSGDVVRFNon Toxin0.4952.97μMSARS coronavirusP59594
ASCNP27P2KSNVVRGWVFGSTMNNKSQSNon Toxin0.4852.38μMSARS coronavirusP59594
ASCNP28P4TDAVDCSQNPLAELKCSVKSFNon Toxin0.4959.07μMSARS coronavirusP59594
ASCNP29P1TSSMRGVYYPDEIFRSDTLYLNon Toxin0.4937.97μMSARS coronavirusP59594
ASCNP30P3YKGYQPIDVVRDLPSGFNTLNon Toxin0.4956.05μMSARS coronavirusP59594
ASCNP31P7YNYKYRYLRHGKLRPFERDINon Toxin0.4943.24μMSARS coronavirusP59594
ASCNP32HR2-1VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNon Toxin0.4741.55μMSARS coronavirusP59594
ASCNP33HR2-2QPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQNon Toxin0.4635.62μMSARS coronavirusP59594
ASCNP34HR2-3SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNENon Toxin0.4434.48μMSARS coronavirusP59594
ASCNP35HR2-4LDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNon Toxin0.4738.88μMSARS coronavirusP59594
ASCNP36HR2-5FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESNon Toxin0.4637.47μMSARS coronavirusP59594
ASCNP37HR2-6PDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQNon Toxin0.4736.96μMSARS coronavirusP59594
ASCNP38HR2-7GDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYNon Toxin0.456.66μMSARS coronavirusP59594
ASCNP39HR2-8ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4632.87μMSARS coronavirusP59594
ASCNP40HR2-9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.470.31μMSARS coronavirusP59594
ASCNP41HR2-10ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.480.46μMSARS coronavirusP59594
ASCNP42HR2-11GINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.471.53μMSARS coronavirusP59594
ASCNP43HR2-12INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4733.54μMSARS coronavirusP59594
ASCNP44HR2-13INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYINon Toxin0.488.61μMSARS coronavirusP59594
ASCNP45HR2-14INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.482.38μMSARS coronavirusP59594
ASCNP46HR2-15INASVVNIQKEIDRLNEVAKNLNESLIDLNon Toxin0.481.64μMSARS coronavirusP59594
ASCNP47HR2-16VVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4833.86μMSARS coronavirusP59594
ASCNP48HR2-17VVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.480.14μMSARS coronavirusP59594
ASCNP49HR2-19IQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4731.99μMSARS coronavirusP59594
ASCNP50HR2-20IDRLNEVAKNLNESLIDLQELGKYEQYIKWPWNon Toxin0.4828.93μMSARS coronavirusP59594
ASCNP51sHR2-1LDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon ToxinNot determined43±6.4μM(EC50)SARS coronavirusP59594
ASCNP52sHR2-2PKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon ToxinNot determined24±2.8μM(EC50)SARS coronavirusP59594
ASCNP53sHR2-3LDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon ToxinNot determined>50μM(EC50)SARS coronavirusP59594
ASCNP54sHR2-4FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon ToxinNot determined>50μM(EC50)SARS coronavirusP59594
ASCNP55sHR2-5TSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon Toxin0.44>50μM(EC50)SARS coronavirusP59594
ASCNP56sHR2-6VDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon Toxin0.45>50μM(EC50)SARS coronavirusP59594
ASCNP57sHR2-7DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon Toxin0.46>50μM(EC50)SARS coronavirusP59594
ASCNP58sHR2-8ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKNon ToxinNot determined17±3.0μM(EC50)SARS coronavirusP59594
ASCNP59sHR2-9ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon ToxinNot determined34±4.0μM(EC50)SARS coronavirusP59594
ASCNP60sHR2-10ELDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDNon ToxinNot determined>50μM(EC50)SARS coronavirusP59594
ASCNP61mHR2DLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKENon Toxin0.48>50μM(EC50)SARS coronavirusP11224
ASCNP62sHR1AYRFNGIQVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITNon ToxinNot determined>50μM(EC50)SARS coronavirusP59594
ASCNP63sHR1cNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITNon Toxin0.49>50μM(EC50)SARS coronavirusP59594
ASCNP64NP-1GVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQNon Toxin0.5017.58μMSARS coronavirusP59594
ASCNP65NP-2LTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGNon Toxin0.5138.05μMSARS coronavirusP59594
ASCNP66NP-3KQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGNon Toxin0.4918.16μMSARS coronavirusP59594
ASCNP67NP-4GRLQSLQTYVTQQLIRAAEIRASANLAATKMSECNon Toxin0.5032.23μMSARS coronavirusP59594
ASCNP68CP-1GINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYENon Toxin0.4719μmol/lSARS coronavirusP59594
ASCNP69CP-2KEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWNon Toxin0.48NoNASARS coronavirusP59594
ASCNP70MucroporinLFGLIPSLIGGLVSAFKNon Toxin0.677.12μM(EC50)SARS coronavirusB9UIY3
ASCNP71Mucroporin-M1LFRLIKSLIKRLVSAFKNon Toxin0.5211.45μMSARS coronavirusB9UIY3
ASCNP72Mucroporin-S1SLIGGLVSAFKNon Toxin0.6347.23μMSARS coronavirusB9UIY3
ASCNP73Mucroporin-S2VSAFKNon Toxin0.4947.07μMSARS coronavirusB9UIY3
ASCNP74SEQ ID NO:1FKLPLGINITNFRAILTAFSNon Toxin0.51>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP75SEQ ID NO:2PTTFMLKYDENGTITDAVDCNon Toxin0.49112.5±26.3IC90 (μg/ml)SARS coronavirusNot found
ASCNP76SEQ ID NO:3VLYNSTFFSTFKCYGVSATKNon Toxin0.49>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP77SEQ ID NO:4PALNCYWPLNDYGFYTTSGINon Toxin0.48>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP78SEQ ID NO:5RDVSDFTDSVRDPKTSEILDNon Toxin0.49>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP79SEQ ID NO:6YQDVNCTDVSTAIHADQLTPNon Toxin0.48113.0±27.6IC90 (μg/ml)SARS coronavirusNot found
ASCNP80SEQ ID NO:7SNNTIAIPTNFSISITTEVMNon Toxin0.49>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP81SEQ ID NO:8QYGSFCTQLNRALSGIAAEQNon Toxin0.4924.9±6.2IC90 (μg/ml)SARS coronavirusNot found
ASCNP82SEQ ID NO:9GIGVTQNVLYENQKQIANQFNon Toxin0.49>500IC90 (μg/ml)SARS coronavirusNot found
ASCNP83SEQ ID NO:10IQKEIDRLNEVAKNLNESLINon Toxin0.4873.5±15.7IC90 (μg/ml)SARS coronavirusNot found
ASCNP84MHVWW-IVGYFVQDDGEWKFTGSSYYYNon Toxin0.494μMmurine hepatitis virusNot found
ASCNP85HR2LSIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNYNon Toxin0.510.5μMMERS coronavirus Not found
ASCNP86HR2PSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELNon Toxin0.490.97 ± 0.15μMMERS coronavirus Not found
ASCNP87HR2P-M1SLTQINTTLLDLEYEMRSLQQVVKALNESYIDLKELNon Toxin0.500.85 ± 0.08μMMERS coronavirus Not found
ASCNP88HR2P-M2SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKELNon Toxin0.480.55 ± 0.04μMMERS coronavirus Not found
ASCNP89HHVTTTFAPPPPRNon Toxin0.4911μg/mlTGEV-coronavirusNot found
ASCNP90SSVVPSKATWGFANon Toxin0.4915μg/mlTGEV-coronavirusNot found
ASCNP91MelittinGIGAVLKVLTTGLPALISWIKRKRQQNon Toxin0.831.65μMHIV, HSV-1 and HNP-2, Junin virus Not found
ASCNP92UruminIPLRGAFINGRWDSQCHRFSNGAIACANon Toxin0.4437.59μMIAV (H1)Not found
ASCNP93NYADITFXDLLXYYGPNon Toxin0.4923.98μMHIV-1Not found
ASCNP94G1LRSRTKIIRIRHNon Toxin0.4881.63μMHIV-1Not found
ASCNP95G2MPRRRRIRRRQKNon Toxin0.4841.78μMHSV-1Not found
ASCNP96Latarcin 1SMWSGMWRRKLKKLRNALKKKLKGENon Toxin0.5141.02μMDENV-2Not found
ASCNP97Epinecidin 1GFIFHIIKGLFHAGKMIHGLVNon Toxin0.4740.65μMJEVNot found
ASCNP98Cecropin AKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKNon Toxin0.172.95μMHIV, HSV-1 and 2, Junin virusNot found
ASCNP99HBD-2, 3LKKLCKLLKKLCKLAGNon Toxin0.5038.67μMHIV-1, HPV, HIV, vaccinia virus, VZVNot found
ASCNP100Hp1036ILGKIWEGIKSIFNon Toxin0.5034.39μMHSV-1, HCVNot found
ASCNP101Hp1239ILSYLWNGIKSIFNon Toxin0.5521.94μMHSV-1, HCVNot found
ASCNP102IndolicidinILPWKWPWWPWRRNon Toxin0.8329.13μMHIVNot found
ASCNP103caerin 1.10GLLSVLGSVAKHVLPHVVPVIAEKLNon Toxin0.4837.59μMSARS coronavirusNot found
ASCNP104caerin 1.6GLFSVLGAVAKHVLPHVVPVIAEKLNon Toxin0.4836.6μMSARS coronavirusNot found

Physicochemical Data

DataBase Content
Peptide IDPeptide nameEmpiric formulaAbsent amino acidsBasic residuesAcidic residuesPolar residuesHydrophobic residuesBoman index
ASCNP1SARSWW-IC105H149N23O25SACDEHRV2076-0,17
ASCNP2SARSWW-IIC110H160N26O29S2CDEHKNRSV006120,73
ASCNP3SARSWW-IIIC120H168N30O27SCDEIKNR305100,48
ASCNP4SARSWW-IVC109H148N26O27ACDEHKLMPY10890,38
ASCNP5SARSWW-VaC183H266N42O51CFHMRT35812-0,7
ASCNP6SARSWW-VbC147H230N36O46SFHMPRT35711-0,41
ASCNP7N46C216H366N64O73CHMPRWY421417-0,46
ASCNP8N46egC216H356N66O83CHMPRWY351811-1,19
ASCNP9EPL5C68H122N26O15ACDEFHLMQSTVW7031-2,62
ASCNP10SR9EK13C171H293N45O59CFHMPRTWY47814-0,3
ASCNP11SR9C168H287N47O58CFHMPTWY36915-0,08
ASCNP12SR9EK1C188H328N50O61CDFGHMPRSTWY1010310-1,49
ASCNP13peptide 9626C100H165N25O23ACDEHMQSVWY30580,34
ASCNP14HR2C168H287N47O58CFHMPTWY36915-0,08
ASCNP15HR1-aC135H218N38O49CDGHMPRVW22118-0,85
ASCNP16GST-removed HR2C235H384N62O82CFHMPTW4101318-0,32
ASCNP17HR1-bC158H273N45O57CFHMPRWY221313-0,13
ASCNP18His6-HR1C281H462N80O96CHMPRW432222-0,32
ASCNP19K10C54H89N13O15ACEFHMNRSTW2123-0,56
ASCNP20K20C86H147N25O28S3DEFRSWY201050,27
ASCNP21K8C32H51N9O14SEFGHIKLMQRSVWY0141-0,91
ASCNP22P9C107H174N30O32S2DEHKMPVW1010100,6
ASCNP23P8C107H156N30O32ACEHILMNWY3255-1,09
ASCNP24P10C128H201N35O34SCDHISW5176-0,87
ASCNP25P6C106H164N28O30SGHLMQ4267-0,55
ASCNP26P5C103H161N29O29ACEHLMW3177-0,13
ASCNP27P2C95H152N30O30SACDEHILPY30105-0,73
ASCNP28P4C95H155N25O34S2GHIMRWY2377-0,12
ASCNP29P1C113H169N27O36SACHKNQW2395-0,39
ASCNP30P3C105H160N26O31ACEHMW2276-0,36
ASCNP31P7C125H187N37O30ACMQSTVW7264-1,59
ASCNP32HR2-1C206H313N49O70CMRW491113-0,5
ASCNP33HR2-2C192H297N49O67CMRW481112-0,63
ASCNP34HR2-3C209H330N56O72CMW691213-0,73
ASCNP35HR2-4C195H316N54O65CMW671114-0,49
ASCNP36HR2-5C192H314N56O68CMWY571314-0,54
ASCNP37HR2-6C187H314N52O67CFHMTWY381016-0,19
ASCNP38HR2-7C191H319N53O66CFHMPTW471215-0,31
ASCNP39HR2-8C243H385N63O74CFHMT571218-0,43
ASCNP40HR2-9C176H302N50O60CFHMPTWY461015-0,19
ASCNP41HR2-10C168H287N47O58CFHMPTWY36915-0,08
ASCNP42HR2-11C167H286N48O57CFHMPTWY46914-0,31
ASCNP43HR2-12C232H366N60O70CFHMT571017-0,53
ASCNP44HR2-13C199H327N53O66CFHMPTW471015-0,4
ASCNP45HR2-14C165H283N47O56CFHMPTWY46814-0,31
ASCNP46HR2-15C141H242N40O48CFGHMPTWY35713-0,1
ASCNP47HR2-16C216H339N55O64CFHMT57815-0,64
ASCNP48HR2-17C149H256N42O50CFHMPTWY46612-0,42
ASCNP49HR2-19C202H315N51O60CFHMT57713-0,83
ASCNP50HR2-20C180H277N45O53CFHMT46712-0,73
ASCNP51sHR2-1C311H500N82O108CMW8141720-0,69
ASCNP52sHR2-2C298H479N79O102CMW8131619-0,72
ASCNP53sHR2-3C277H446N74O94CMW7111619-0,55
ASCNP54sHR2-4C252H409N69O87CMW6101518-0,5
ASCNP55sHR2-5C227H375N61O82CFHMW4101417-0,38
ASCNP56sHR2-6C211H351N57O74CFHMPTW491217-0,26
ASCNP57sHR2-7C194H323N53O68CFHMPTW481115-0,39
ASCNP58sHR2-8C346H549N89O117CMW9151822-0,69
ASCNP59sHR2-9C298H478N78O104CMW7141521-0,56
ASCNP60sHR2-10C272H439N73O97CMW7131518-0,69
ASCNP61mHR2C207H337N51O67SCGHPW581014-0,43
ASCNP62sHR1C465H766N132O152CHMPW883038-0,2
ASCNP63sHR1cC218H369N63O73CHMPWY4513200
ASCNP64NP-1C191H316N54O65CDHMPRW321513-0,5
ASCNP65NP-2C154H260N44O53CEHIMPRWY211413-0,07
ASCNP66NP-3C171H290N48O57CHMPWY4510150,06
ASCNP67NP-4C157H269N49O51S2DFHPW421013-0,13
ASCNP68CP-1C181H302N50O62CFHMPTW471014-0,42
ASCNP69CP-2C216H324N52O61CFHMT57814-0,78
ASCNP70MucroporinC85H138N18O20CDEHMNQRTWY105101,62
ASCNP71Mucroporin-M1C98H170N26O20CDEGHMNPQTWY502100,79
ASCNP72Mucroporin-S1C51H86N12O14CDEHMNPQRTWY10461,33
ASCNP73Mucroporin-S2C26H42N6O7CDEGHILMNPQRTWY10130,82
ASCNP74SEQ ID NO:1C107H170N26O26CDEHMQVWY206110,87
ASCNP75SEQ ID NO:2C96H148N22O35S2HQRSW1485-0,3
ASCNP76SEQ ID NO:3C106H155N23O30SDEHIMPQRW201170,31
ASCNP77SEQ ID NO:4C108H147N23O31SEHKMQRV01116-0,12
ASCNP78SEQ ID NO:5C96H155N27O38ACGHMNQWY3655-0,99
ASCNP79SEQ ID NO:6C92H143N25O35SEFGKMRW1376-0,36
ASCNP80SEQ ID NO:7C93H153N23O33SCDGHKLQRWY011070,4
ASCNP81SEQ ID NO:8C92H145N27O31SDHKMPVW1187-0,18
ASCNP82SEQ ID NO:9C100H158N28O32CDHMPRSW1177-0,45
ASCNP83SEQ ID NO:10C101H175N29O34CFGHMPTWY3448-0,51
ASCNP84MHVWW-IVC110H138N22O34ACHILMNPR13104-0,93
ASCNP85HR2LC229H366N54O74SCHRW2517160,01
ASCNP86HR2PC185H307N43O61SCFGHPRW2511140,13
ASCNP87HR2P-M1C186H308N46O62SCFGHPW361013-0,18
ASCNP88HR2P-M2C193H321N43O64SACFGHPRW59812-0,41
ASCNP89HC61H93N17O16CDEGIKLMNQSWY2033-0,62
ASCNP90SC59H88N14O16CDEHILMNQRY10460,48
ASCNP91MelittinC131H228N38O32CDEFHMNY506120,27
ASCNP92UruminC129H198N42O35S2EKMTVY41911-0,03
ASCNP93NYADC60H80N10O14ACEHKMNQRSVW01440,51
ASCNP94G1C67H125N27O15ACDEFGMNPQVWY6024-0,78
ASCNP95G2C69H133N35O14SACDEFGHLNSTVWY8001-2,84
ASCNP96Latarcin 1C138H238N44O31S2CDFHIPQTVY10157-1,25
ASCNP97Epinecidin 1C114H175N29O22SCDENPQRSTWY504111,09
ASCNP98Cecropin AC184H312N52O47CHMSY82617-0,07
ASCNP99HBD-2, 3C83H158N22O17S2DEFHIMNPQRSTVWY60370,36
ASCNP100Hp1036C74H118N16O17ACDHMNPQRTVY21370,83
ASCNP101Hp1239C77H116N16O18ACDEHMPQRTV10570,95
ASCNP102IndolicidinC100H131N25O14ACDEFGHMNQSTVY3007-1,07
ASCNP103caerin 1.10C121H207N31O30CDFMNQRTWY414141,16
ASCNP104caerin 1.6C124H205N31O29CDMNQRTWY413151,22
ASCNP1SARSWW-IC105H149N23O25SACDEHRV2076-0,17
ASCNP2SARSWW-IIC110H160N26O29S2CDEHKNRSV006120,73
ASCNP3SARSWW-IIIC120H168N30O27SCDEIKNR305100,48
ASCNP4SARSWW-IVC109H148N26O27ACDEHKLMPY10890,38
ASCNP5SARSWW-VaC183H266N42O51CFHMRT35812-0,7
ASCNP6SARSWW-VbC147H230N36O46SFHMPRT35711-0,41
ASCNP7N46C216H366N64O73CHMPRWY421417-0,46
ASCNP8N46egC216H356N66O83CHMPRWY351811-1,19
ASCNP9EPL5C68H122N26O15ACDEFHLMQSTVW7031-2,62
ASCNP10SR9EK13C171H293N45O59CFHMPRTWY47814-0,3
ASCNP11SR9C168H287N47O58CFHMPTWY36915-0,08
ASCNP12SR9EK1C188H328N50O61CDFGHMPRSTWY1010310-1,49
ASCNP13peptide 9626C100H165N25O23ACDEHMQSVWY30580,34
ASCNP14HR2C168H287N47O58CFHMPTWY36915-0,08
ASCNP15HR1-aC135H218N38O49CDGHMPRVW22118-0,85
ASCNP16GST-removed HR2C235H384N62O82CFHMPTW4101318-0,32
ASCNP17HR1-bC158H273N45O57CFHMPRWY221313-0,13
ASCNP18His6-HR1C281H462N80O96CHMPRW432222-0,32
ASCNP19K10C54H89N13O15ACEFHMNRSTW2123-0,56
ASCNP20K20C86H147N25O28S3DEFRSWY201050,27
ASCNP21K8C32H51N9O14SEFGHIKLMQRSVWY0141-0,91
ASCNP22P9C107H174N30O32S2DEHKMPVW1010100,6
ASCNP23P8C107H156N30O32ACEHILMNWY3255-1,09
ASCNP24P10C128H201N35O34SCDHISW5176-0,87
ASCNP25P6C106H164N28O30SGHLMQ4267-0,55
ASCNP26P5C103H161N29O29ACEHLMW3177-0,13
ASCNP27P2C95H152N30O30SACDEHILPY30105-0,73
ASCNP28P4C95H155N25O34S2GHIMRWY2377-0,12
ASCNP29P1C113H169N27O36SACHKNQW2395-0,39
ASCNP30P3C105H160N26O31ACEHMW2276-0,36
ASCNP31P7C125H187N37O30ACMQSTVW7264-1,59
ASCNP32HR2-1C206H313N49O70CMRW491113-0,5
ASCNP33HR2-2C192H297N49O67CMRW481112-0,63
ASCNP34HR2-3C209H330N56O72CMW691213-0,73
ASCNP35HR2-4C195H316N54O65CMW671114-0,49
ASCNP36HR2-5C192H314N56O68CMWY571314-0,54
ASCNP37HR2-6C187H314N52O67CFHMTWY381016-0,19
ASCNP38HR2-7C191H319N53O66CFHMPTW471215-0,31
ASCNP39HR2-8C243H385N63O74CFHMT571218-0,43
ASCNP40HR2-9C176H302N50O60CFHMPTWY461015-0,19
ASCNP41HR2-10C168H287N47O58CFHMPTWY36915-0,08
ASCNP42HR2-11C167H286N48O57CFHMPTWY46914-0,31
ASCNP43HR2-12C232H366N60O70CFHMT571017-0,53
ASCNP44HR2-13C199H327N53O66CFHMPTW471015-0,4
ASCNP45HR2-14C165H283N47O56CFHMPTWY46814-0,31
ASCNP46HR2-15C141H242N40O48CFGHMPTWY35713-0,1
ASCNP47HR2-16C216H339N55O64CFHMT57815-0,64
ASCNP48HR2-17C149H256N42O50CFHMPTWY46612-0,42
ASCNP49HR2-19C202H315N51O60CFHMT57713-0,83
ASCNP50HR2-20C180H277N45O53CFHMT46712-0,73
ASCNP51sHR2-1C311H500N82O108CMW8141720-0,69
ASCNP52sHR2-2C298H479N79O102CMW8131619-0,72
ASCNP53sHR2-3C277H446N74O94CMW7111619-0,55
ASCNP54sHR2-4C252H409N69O87CMW6101518-0,5
ASCNP55sHR2-5C227H375N61O82CFHMW4101417-0,38
ASCNP56sHR2-6C211H351N57O74CFHMPTW491217-0,26
ASCNP57sHR2-7C194H323N53O68CFHMPTW481115-0,39
ASCNP58sHR2-8C346H549N89O117CMW9151822-0,69
ASCNP59sHR2-9C298H478N78O104CMW7141521-0,56
ASCNP60sHR2-10C272H439N73O97CMW7131518-0,69
ASCNP61mHR2C207H337N51O67SCGHPW581014-0,43
ASCNP62sHR1C465H766N132O152CHMPW883038-0,2
ASCNP63sHR1cC218H369N63O73CHMPWY4513200
ASCNP64NP-1C191H316N54O65CDHMPRW321513-0,5
ASCNP65NP-2C154H260N44O53CEHIMPRWY211413-0,07
ASCNP66NP-3C171H290N48O57CHMPWY4510150,06
ASCNP67NP-4C157H269N49O51S2DFHPW421013-0,13
ASCNP68CP-1C181H302N50O62CFHMPTW471014-0,42
ASCNP69CP-2C216H324N52O61CFHMT57814-0,78
ASCNP70MucroporinC85H138N18O20CDEHMNQRTWY105101,62
ASCNP71Mucroporin-M1C98H170N26O20CDEGHMNPQTWY502100,79
ASCNP72Mucroporin-S1C51H86N12O14CDEHMNPQRTWY10461,33
ASCNP73Mucroporin-S2C26H42N6O7CDEGHILMNPQRTWY10130,82
ASCNP74SEQ ID NO:1C107H170N26O26CDEHMQVWY206110,87
ASCNP75SEQ ID NO:2C96H148N22O35S2HQRSW1485-0,3
ASCNP76SEQ ID NO:3C106H155N23O30SDEHIMPQRW201170,31
ASCNP77SEQ ID NO:4C108H147N23O31SEHKMQRV01116-0,12
ASCNP78SEQ ID NO:5C96H155N27O38ACGHMNQWY3655-0,99
ASCNP79SEQ ID NO:6C92H143N25O35SEFGKMRW1376-0,36
ASCNP80SEQ ID NO:7C93H153N23O33SCDGHKLQRWY011070,4
ASCNP81SEQ ID NO:8C92H145N27O31SDHKMPVW1187-0,18
ASCNP82SEQ ID NO:9C100H158N28O32CDHMPRSW1177-0,45
ASCNP83SEQ ID NO:10C101H175N29O34CFGHMPTWY3448-0,51
ASCNP84MHVWW-IVC110H138N22O34ACHILMNPR13104-0,93
ASCNP85HR2LC229H366N54O74SCHRW2517160,01
ASCNP86HR2PC185H307N43O61SCFGHPRW2511140,13
ASCNP87HR2P-M1C186H308N46O62SCFGHPW361013-0,18
ASCNP88HR2P-M2C193H321N43O64SACFGHPRW59812-0,41
ASCNP89HC61H93N17O16CDEGIKLMNQSWY2033-0,62
ASCNP90SC59H88N14O16CDEHILMNQRY10460,48
ASCNP91MelittinC131H228N38O32CDEFHMNY506120,27
ASCNP92UruminC129H198N42O35S2EKMTVY41911-0,03
ASCNP93NYADC60H80N10O14ACEHKMNQRSVW01440,51
ASCNP94G1C67H125N27O15ACDEFGMNPQVWY6024-0,78
ASCNP95G2C69H133N35O14SACDEFGHLNSTVWY8001-2,84
ASCNP96Latarcin 1C138H238N44O31S2CDFHIPQTVY10157-1,25
ASCNP97Epinecidin 1C114H175N29O22SCDENPQRSTWY504111,09
ASCNP98Cecropin AC184H312N52O47CHMSY82617-0,07
ASCNP99HBD-2, 3C83H158N22O17S2DEFHIMNPQRSTVWY60370,36
ASCNP100Hp1036C74H118N16O17ACDHMNPQRTVY21370,83
ASCNP101Hp1239C77H116N16O18ACDEHMPQRTV10570,95
ASCNP102IndolicidinC100H131N25O14ACDEFGHMNQSTVY3007-1,07
ASCNP103caerin 1.10C121H207N31O30CDFMNQRTWY414141,16
ASCNP104caerin 1.6C124H205N31O29CDMNQRTWY413151,22

Literature Data

DataBase Content
Peptide IDPeptide nameSequenceTitleAuthorsJournalPMID
ASCNP1SARSWW-IMWKTPTLKYFGGFNFSQIInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP2SARSWW-IIATAGWTFGAGAALQIPFAMQMAYInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP3SARSWW-IIIGYHLMSFPQAAPHGVVFLHVTWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP4SARSWW-IVGVFVFNGTSWFITQRNFFSInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP5SARSWW-VaNEVAKNLNESLIDLQELGKYEQYIKWPWYVWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP6SARSWW-VbAACEVAKNLNESLIDLQELGKYEQYIKWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP7N46QKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP8N46egQNQSANQFQKEISQINEVLTTTNTSLGKLQDDVNQNNQSLNTLQKEIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP9EPL5KKKKYRNIRRPGIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP10SR9EK13ISGINASVVNIQEEIKKLNEEAKKLNESLIDLQELIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP11SR9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP12SR9EK1IEEINKKVEEIQKKIEELNKKAEELNKKLEELQKKDesign, synthesis and screening of antisense peptide based combinatorial peptide libraries towards an aromatic region of SARS-CoV.Huang Y, Zhao R, Luo J, Xiong S, Shangguan D, Zhang H, Liu G, Chen Y.J Mol Recognit. 2008https://pubmed.ncbi.nlm.nih.gov/18383098/
ASCNP13peptide 9626TLKPIFKLPLGINITNFRHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/588
ASCNP14HR2ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/589
ASCNP15HR1-aYENQKQIANQFNKAISQIQESLTTTSTAHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/590
ASCNP16GST-removed HR2DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIIdentification of a new region of SARS-CoV S protein critical for viral entry.Guo Y, Tisoncik J, McReynolds S, Farzan M, Prabhakar BS, Gallagher T, Rong L, Caffrey M.J Mol Biol. 2009https://pubmed.ncbi.nlm.nih.gov/19853613/
ASCNP17HR1-bIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP18His6-HR1YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP19K10DLKGKYVQIPFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP2SARSWW-IIATAGWTFGAGAALQIPFAMQMAYInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP3SARSWW-IIIGYHLMSFPQAAPHGVVFLHVTWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP4SARSWW-IVGVFVFNGTSWFITQRNFFSInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP5SARSWW-VaNEVAKNLNESLIDLQELGKYEQYIKWPWYVWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP6SARSWW-VbAACEVAKNLNESLIDLQELGKYEQYIKWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP7N46QKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP8N46egQNQSANQFQKEISQINEVLTTTNTSLGKLQDDVNQNNQSLNTLQKEIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP9EPL5KKKKYRNIRRPGIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP10SR9EK13ISGINASVVNIQEEIKKLNEEAKKLNESLIDLQELIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP11SR9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP12SR9EK1IEEINKKVEEIQKKIEELNKKAEELNKKLEELQKKDesign, synthesis and screening of antisense peptide based combinatorial peptide libraries towards an aromatic region of SARS-CoV.Huang Y, Zhao R, Luo J, Xiong S, Shangguan D, Zhang H, Liu G, Chen Y.J Mol Recognit. 2008https://pubmed.ncbi.nlm.nih.gov/18383098/
ASCNP13peptide 9626TLKPIFKLPLGINITNFRHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/588
ASCNP14HR2ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/589
ASCNP15HR1-aYENQKQIANQFNKAISQIQESLTTTSTAHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/590
ASCNP16GST-removed HR2DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIIdentification of a new region of SARS-CoV S protein critical for viral entry.Guo Y, Tisoncik J, McReynolds S, Farzan M, Prabhakar BS, Gallagher T, Rong L, Caffrey M.J Mol Biol. 2009https://pubmed.ncbi.nlm.nih.gov/19853613/
ASCNP17HR1-bIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP18His6-HR1YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP19K10DLKGKYVQIPFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP20K20NCVKMLCTHTGTGQAITVTPShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP21K8PTTCANDPShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP22P9CANLLLQYGSFCTQLNRALSGIAShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP23P8PSSKRFQPFQQFGRDVSDFTShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP24P10RNTREVFAQVKQMYKTPTLKYFGShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP25P6TKFPSVYAWERKKISNCVADSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP26P5KGIYQTSNFRVVPSGDVVRFSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP27P2KSNVVRGWVFGSTMNNKSQSSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP28P4TDAVDCSQNPLAELKCSVKSFSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP29P1TSSMRGVYYPDEIFRSDTLYLSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP30P3YKGYQPIDVVRDLPSGFNTLSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP31P7YNYKYRYLRHGKLRPFERDISynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP32HR2-1VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP33HR2-2QPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP34HR2-3SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNESynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP35HR2-4LDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP36HR2-5FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP37HR2-6PDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP38HR2-7GDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP39HR2-8ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP40HR2-9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP41HR2-10ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP42HR2-11GINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP43HR2-12INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP44HR2-13INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYISuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP45HR2-14INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP46HR2-15INASVVNIQKEIDRLNEVAKNLNESLIDLSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP47HR2-16VVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP48HR2-17VVNIQKEIDRLNEVAKNLNESLIDLQELGKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP49HR2-19IQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP50HR2-20IDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP51sHR2-1LDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP52sHR2-2PKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP53sHR2-3LDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP54sHR2-4FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP55sHR2-5TSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP56sHR2-6VDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP57sHR2-7DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP58sHR2-8ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP59sHR2-9ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP60sHR2-10ELDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP61mHR2DLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP62sHR1AYRFNGIQVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP63sHR1cNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP64NP-1GVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP65NP-2LTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP66NP-3KQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP67NP-4GRLQSLQTYVTQQLIRAAEIRASANLAATKMSECInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP68CP-1GINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP69CP-2KEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP70MucroporinLFGLIPSLIGGLVSAFKInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP71Mucroporin-M1LFRLIKSLIKRLVSAFKInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP72Mucroporin-S1SLIGGLVSAFKInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP73Mucroporin-S2VSAFKVirucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses.Li Q, Zhao Z, Zhou D, Chen Y, Hong W, Cao L, Yang J, Zhang Y, Shi W, Cao Z, Wu Y, Yan H, Li W.Peptides. 2011https://pubmed.ncbi.nlm.nih.gov/21620914/
ASCNP74SEQ ID NO:1FKLPLGINITNFRAILTAFSVirucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses.Li Q, Zhao Z, Zhou D, Chen Y, Hong W, Cao L, Yang J, Zhang Y, Shi W, Cao Z, Wu Y, Yan H, Li W.Peptides. 2011https://pubmed.ncbi.nlm.nih.gov/21620914/
ASCNP75SEQ ID NO:2PTTFMLKYDENGTITDAVDCVirucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses.Li Q, Zhao Z, Zhou D, Chen Y, Hong W, Cao L, Yang J, Zhang Y, Shi W, Cao Z, Wu Y, Yan H, Li W.Peptides. 2011https://pubmed.ncbi.nlm.nih.gov/21620914/
ASCNP76SEQ ID NO:3VLYNSTFFSTFKCYGVSATKVirucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses.Li Q, Zhao Z, Zhou D, Chen Y, Hong W, Cao L, Yang J, Zhang Y, Shi W, Cao Z, Wu Y, Yan H, Li W.Peptides. 2011https://pubmed.ncbi.nlm.nih.gov/21620914/
ASCNP77SEQ ID NO:4PALNCYWPLNDYGFYTTSGISynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61522
ASCNP78SEQ ID NO:5RDVSDFTDSVRDPKTSEILDSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61523
ASCNP79SEQ ID NO:6YQDVNCTDVSTAIHADQLTPSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61524
ASCNP80SEQ ID NO:7SNNTIAIPTNFSISITTEVMSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61525
ASCNP81SEQ ID NO:8QYGSFCTQLNRALSGIAAEQSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61526
ASCNP82SEQ ID NO:9GIGVTQNVLYENQKQIANQFSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61527
ASCNP83SEQ ID NO:10IQKEIDRLNEVAKNLNESLISynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61528
ASCNP84MHVWW-IVGYFVQDDGEWKFTGSSYYYSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61529
ASCNP85HR2LSIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNYSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61530
ASCNP86HR2PSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61531
ASCNP87HR2P-M1SLTQINTTLLDLEYEMRSLQQVVKALNESYIDLKELInhibition of severe acute respiratory syndrome-associated coronavirus(SARS-CoV) infectivity by peptides analogous to the viral spike proteinSainz B, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, et alVirusRes 2006;120(1-2):14655https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP88HR2P-M2SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKELStructure-based discovery ofMiddle East Respiratory Syndrome Coronavirus fusion inhibitor.Sainz B, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, et alVirusRes 2006;120(1-2):14656https://pubmed.ncbi.nlm.nih.gov/24473083/
ASCNP89HHVTTTFAPPPPRStructure-based discovery ofMiddle East Respiratory Syndrome Coronavirus fusion inhibitor.Sainz B, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, et alVirusRes 2006;120(1-2):14657https://pubmed.ncbi.nlm.nih.gov/24473083/
ASCNP90SSVVPSKATWGFAStructure-based discovery ofMiddle East Respiratory Syndrome Coronavirus fusion inhibitor.Sainz B, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, et alVirusRes 2006;120(1-2):14658https://pubmed.ncbi.nlm.nih.gov/24473083/
ASCNP91MelittinGIGAVLKVLTTGLPALISWIKRKRQQProtec-tive effect of intranasal regimens containing peptidic Middle East RespiratorySyndrome Coronavirus fusion inhibitor against MERS-CoV InfectionChannappanavar R, Lu L, Xia S, Du L, Meyerholz DK, Perlman S, et alJ InfectDis 2015;212(12):1894903.https://pubmed.ncbi.nlm.nih.gov/26164863/
ASCNP92UruminIPLRGAFINGRWDSQCHRFSNGAIACAPhage displayed peptides recognizing porcineaminopeptidase N inhibit transmissible gastroenteritis coronavirus infectionin vitroRen X, Liu B, Yin J, Zhang H, Li GVirology 2011;410(2):299306https://pubmed.ncbi.nlm.nih.gov/21176936/
ASCNP93NYADITFXDLLXYYGPPhage displayed peptides recognizing porcineaminopeptidase N inhibit transmissible gastroenteritis coronavirus infectionin vitroRen X, Liu B, Yin J, Zhang H, Li GVirology 2011;410(2):299307https://pubmed.ncbi.nlm.nih.gov/21176936/
ASCNP94G1LRSRTKIIRIRHThe catalytic subunit of the SWR1 remodeler is a histone chaperone for the H2A.Z-H2B dimerHong J, et al. (2014)Mol Cell53(3):498-505https://www.yeastgenome.org/reference/S000156974
ASCNP95G2MPRRRRIRRRQKAn Amphibian Host Defense Peptide Is Virucidal for Human H1 Hemagglutinin-Bearing Influenza VirusesDavid J Holthausen1,Song Hee Lee1,Vineeth Tv Kumar2,Nicole M Bouvier3,Florian Krammer3,Ali H Ellebedy1,Jens Wrammert1,Anice C Lowen1,Sanil George2,Madhavan Radhakrishna Pillai2,Joshy JacobImmunity 2017 Apr 18;46(4):587-595.https://pubmed.ncbi.nlm.nih.gov/28423338/
ASCNP96Latarcin 1SMWSGMWRRKLKKLRNALKKKLKGESpn1 regulates the recruitment of Spt6 and the Swi/Snf complex during transcriptional activation by RNA polymerase IIZhang L, et al. (2008)Mol Cell Biol28(4):1393-403https://www.yeastgenome.org/reference/S000125985
ASCNP97Epinecidin 1GFIFHIIKGLFHAGKMIHGLVPHYTOCHEMICAL CONSTITUENTS AND ANTIMICROBIAL ACTIVITIES OF THE ROOT BARK EXTRACTS OF Massularia acuminata sppU. S. Ukekpe1,2,*, H. M. Adamu2 , E.O. Ekanem2 and A. A. Saleh3International Journal of Advanced Research (IJAR)http://www.journalijar.com/article/5741/phytochemical-constituents-and-antimicrobial-activities-of-the-root-bark-extracts-of-massularia-acuminata-spp./
ASCNP98Cecropin AKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKPHYTOCHEMICAL CONSTITUENTS AND ANTIMICROBIAL ACTIVITIES OF THE ROOT BARK EXTRACTS OF Massularia acuminata sppU. S. Ukekpe1,2,*, H. M. Adamu2 , E.O. Ekanem2 and A. A. Saleh4International Journal of Advanced Research (IJAR)http://www.journalijar.com/article/5741/phytochemical-constituents-and-antimicrobial-activities-of-the-root-bark-extracts-of-massularia-acuminata-spp./
ASCNP99HBD-2, 3LKKLCKLLKKLCKLAGIdentification of crucial yeast inhibitors in bio-ethanol and improvement of fermentation at high pH and high total solidsHuang H, et al. (2011)Bioresour Technolhttps://www.yeastgenome.org/reference/S000145571
ASCNP100Hp1036ILGKIWEGIKSIFVirocidal activity of Egyptian scorpion venoms against hepatitis C virus Hepatitis virusesAlaa M H El-Bitar12,Moustafa M H Sarhan3,Chie Aoki4,Yusuke Takahara5,Mari Komoto6,Lin Deng7,Mohsen A Moustafa8,Hak Hotta9Virology Journalhttps://pubmed.ncbi.nlm.nih.gov/25889296/
ASCNP101Hp1239ILSYLWNGIKSIFVirocidal activity of Egyptian scorpion venoms against hepatitis C virus Hepatitis virusesAlaa M H El-Bitar12,Moustafa M H Sarhan3,Chie Aoki4,Yusuke Takahara5,Mari Komoto6,Lin Deng7,Mohsen A Moustafa8,Hak Hotta9Virology Journalhttps://pubmed.ncbi.nlm.nih.gov/25889296/
ASCNP102IndolicidinILPWKWPWWPWRRSources of plastic marine debris on beaches of Korea: More from the ocean than the landYong Chang Jang, Jongmyoung Lee, Sunwook Hong, Jong Su Lee, Won Joon Shim & Young Kyoung Song Ocean Science Journalhttps://link.springer.com/article/10.1007/s12601-014-0015-8
ASCNP103caerin 1.10GLLSVLGSVAKHVLPHVVPVIAEKLThe catalytic subunit of the SWR1 remodeler is a histone chaperone for the H2A.Z-H2B dimerHong J, et alMol Cellhttps://www.yeastgenome.org/reference/S000156975
ASCNP104caerin 1.6GLFSVLGAVAKHVLPHVVPVIAEKLModulation of the induction or expression of psychostimulant sensitization by the circumstances surrounding drug administrationT E Robinson 1, K E Browman, H S Crombag, A BadianiNeurosci Biobehav Revhttps://pubmed.ncbi.nlm.nih.gov/9579324/