AntiCov_db

General Data

DataBase Content
Peptide IDPeptide nameSequenceToxicityHemolytic potencyInhibitor IC50UnitTarget organismUniprot id
ACP1EK1SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELNon Toxin0.480.19µMSARS-CoV-2Q8BB25
ACP2EK1PSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELNon Toxin0.480.0692µMSARS-CoV-2Q8BB25
ACP3EK1CSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELNon Toxin0.480.037-0.048µMSARS-CoV-2Q8BB25
ACP4EK1C1SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELNon Toxin0.480.057µMSARS-CoV-2Q8BB25
ACP5EK1C2SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGNon Toxin0.480.0482µMSARS-CoV-2not found
ACP6EK1C3SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGNon Toxin0.480.0106µMSARS-CoV-2not found
ACP7EK1C4SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGNon Toxin0.480.0025µMMERS-CoVnot found
ACP8EK1C5SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGNon Toxin0.480.0031µMSARS-CoV-2not found
ACP9EK1C6SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGNon Toxin0.480.0039µMSARS-CoV-2not found
ACP10EK1C7SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGNon Toxin0.480.0039µMSARS-CoV-2not found
ACP11SARS-CoV-2-S(11681203)DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.48>5µMMERS-CoVQ3I5J5
ACP12MBD-4 (11-40), P9NGAICWGPCPTAFRQIGNCGHFKVRCCKIRNon Toxin0,472.4µg/mlSARS-CoV-2not found
ACP13SARS-CoV-S (1151-1185), SR9, SARS-CoV-2-S (1169-1203), IPB01ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.480.022µMSARS-CoV-2P59594
ACP14ATN-161PHSCNnot determined 0,493.16µMSARS-CoV-2not found
ACP15AHB1DEDLEELERLYRKAEEVAKEAKDASRRGDDERAKEQMERAMRLFDQVFELAQELQEKQTDGNRQKATHLDKAVKEAADELYQRVRNon Toxinnot determined0.035µMSARS-CoV-2not found
ACP16AHB2ELEEQVMHVLDQVSELAHELLHKLTGEELERAAYFNWWATEMMLELIKSDDEREIREIEEEARRILEHLEELARKNon Toxinnot determined0.0155µMSARS-CoV-2not found
ACP17LCB1DKEWILQKIYEIMRLLDELGHAEASMRVSDLIYEFMKKGDERLLEEAERLLEEVERNon Toxinnot determined0.00002354µMSARS-CoV-2not found
ACP18LCB3NDDELHMLMTDLVYEALHFAKDEEIKKRVFQLFELADKAYKNNDRQKLEKVVEELKELLERLLSNon Toxinnot determined0.0000481µMSARS-CoV-2not found
ACP19MBD-4 (11-40) / P9 [H21R,K23R,K28R], P9RNGAICWGPCPTAFRQIGNCGRFRVRCCRIRNon Toxin0,460.9µg/mlSARS-CoV-2P82019
ACP20SARS-CoV-2-S (1169-1203)-K, IPB02ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELKNon Toxin0,470.025µMSARS-CoV-2P59594
ACP21SARS-CoV-2-S (1172-1205), IPB03INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.480.015µMSARS-CoV-2P59594
ACP22SARS-CoV-2-S (1175-1205), IPB04SVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.480.033µMSARS-CoV-2P0DTC2
ACP23SARS-CoV-2-S (1179-1205), IPB05IQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.48>5µMSARS-CoV-2not found
ACP24SARS-CoV-2-S (1183-1205), IPB06IDRLNEVAKNLNESLIDLQELGKNon Toxin0,49>5µMSARS-CoV-2not found
ACP25SARS-CoV-2-S (1179-1211), IPB07IQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKNon Toxin0,470.017µMSARS-CoV-2P59594
ACP26SARS-CoV-2-S (1169-1198)-K, IPB08ISGINASVVNIQKEIDRLNEVAKNLNESLIKNon Toxin0.484.66µMSARS-CoV-2P0DTC2
ACP27SARS-CoV-2-S (1175-1198)-K, IPB09SVVNIQKEIDRLNEVAKNLNESLIKNon Toxin0.48>5µMSARS-CoV-2P59594
ACP28[SARS HRC-PEG4]2-cholDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGSGSGCDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGSGSGCNon Toxinnot dtermined 0.2806µMSARS-CoV-2not found
ACP29MERS-CoV-HR2P-GSGSGCSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGSGSGCNon Toxin0,53>0.65µMSARS-CoV-2not found
ACP30EK1-GSGSGCSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGCNon Toxin0,480.293µMSARS-CoV-2not found
ACP31CMKRVKRnot determined 0,490.057µMSARS-CoV-2not found
ACP32ACE2 (27-41)TFLDKFNHEAEDLFYQNon Toxin0,493000µMSARS-CoV-2Q9BYF1
ACP33ACE2 (37-42)EDLFYQnot determined 0,493000µMSARS-CoV-2not found
ACP34Alisporivir, Debio-025XXXVXAAXXXXnot determined 0,490.46µMSARS-CoV-2not found
ACP1EK1SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELNon Toxin0.480.19µMSARS-CoV-2Q8BB25
ACP2EK1PSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELNon Toxin0.480.0692µMSARS-CoV-2Q8BB25
ACP3EK1CSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELNon Toxin0.480.037-0.048µMSARS-CoV-2Q8BB25
ACP4EK1C1SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELNon Toxin0.480.057µMSARS-CoV-2Q8BB25
ACP5EK1C2SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGNon Toxin0.480.0482µMSARS-CoV-2not found
ACP6EK1C3SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGNon Toxin0.480.0106µMSARS-CoV-2not found
ACP7EK1C4SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGNon Toxin0.480.0025µMMERS-CoVnot found
ACP8EK1C5SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGNon Toxin0.480.0031µMSARS-CoV-2not found
ACP9EK1C6SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGNon Toxin0.480.0039µMSARS-CoV-2not found
ACP10EK1C7SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGNon Toxin0.480.0039µMSARS-CoV-2not found
ACP11SARS-CoV-2-S(11681203)DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.48>5µMMERS-CoVQ3I5J5
ACP12MBD-4 (11-40), P9NGAICWGPCPTAFRQIGNCGHFKVRCCKIRNon Toxin0,472.4µg/mlSARS-CoV-2not found
ACP13SARS-CoV-S (1151-1185), SR9, SARS-CoV-2-S (1169-1203), IPB01ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELNon Toxin0.480.022µMSARS-CoV-2P59594
ACP14ATN-161PHSCNnot determined 0,493.16µMSARS-CoV-2not found
ACP15AHB1DEDLEELERLYRKAEEVAKEAKDASRRGDDERAKEQMERAMRLFDQVFELAQELQEKQTDGNRQKATHLDKAVKEAADELYQRVRNon Toxinnot determined0.035µMSARS-CoV-2not found
ACP16AHB2ELEEQVMHVLDQVSELAHELLHKLTGEELERAAYFNWWATEMMLELIKSDDEREIREIEEEARRILEHLEELARKNon Toxinnot determined0.0155µMSARS-CoV-2not found
ACP17LCB1DKEWILQKIYEIMRLLDELGHAEASMRVSDLIYEFMKKGDERLLEEAERLLEEVERNon Toxinnot determined0.00002354µMSARS-CoV-2not found
ACP18LCB3NDDELHMLMTDLVYEALHFAKDEEIKKRVFQLFELADKAYKNNDRQKLEKVVEELKELLERLLSNon Toxinnot determined0.0000481µMSARS-CoV-2not found
ACP19MBD-4 (11-40) / P9 [H21R,K23R,K28R], P9RNGAICWGPCPTAFRQIGNCGRFRVRCCRIRNon Toxin0,460.9µg/mlSARS-CoV-2P82019
ACP20SARS-CoV-2-S (1169-1203)-K, IPB02ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELKNon Toxin0,470.025µMSARS-CoV-2P59594
ACP21SARS-CoV-2-S (1172-1205), IPB03INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.480.015µMSARS-CoV-2P59594
ACP22SARS-CoV-2-S (1175-1205), IPB04SVVNIQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.480.033µMSARS-CoV-2P0DTC2
ACP23SARS-CoV-2-S (1179-1205), IPB05IQKEIDRLNEVAKNLNESLIDLQELGKNon Toxin0.48>5µMSARS-CoV-2not found
ACP24SARS-CoV-2-S (1183-1205), IPB06IDRLNEVAKNLNESLIDLQELGKNon Toxin0,49>5µMSARS-CoV-2not found
ACP25SARS-CoV-2-S (1179-1211), IPB07IQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKNon Toxin0,470.017µMSARS-CoV-2P59594
ACP26SARS-CoV-2-S (1169-1198)-K, IPB08ISGINASVVNIQKEIDRLNEVAKNLNESLIKNon Toxin0.484.66µMSARS-CoV-2P0DTC2
ACP27SARS-CoV-2-S (1175-1198)-K, IPB09SVVNIQKEIDRLNEVAKNLNESLIKNon Toxin0.48>5µMSARS-CoV-2P59594
ACP28[SARS HRC-PEG4]2-cholDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGSGSGCDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGSGSGCNon Toxinnot dtermined 0.2806µMSARS-CoV-2not found
ACP29MERS-CoV-HR2P-GSGSGCSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGSGSGCNon Toxin0,53>0.65µMSARS-CoV-2not found
ACP30EK1-GSGSGCSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSGCNon Toxin0,480.293µMSARS-CoV-2not found
ACP31CMKRVKRnot determined 0,490.057µMSARS-CoV-2not found
ACP32ACE2 (27-41)TFLDKFNHEAEDLFYQNon Toxin0,493000µMSARS-CoV-2Q9BYF1
ACP33ACE2 (37-42)EDLFYQnot determined 0,493000µMSARS-CoV-2not found
ACP34Alisporivir, Debio-025XXXVXAAXXXXnot determined 0,490.46µMSARS-CoV-2not found

Physicochemical Data

DataBase Content
Peptide IDPeptide nameEmpiric formulaAbsent amino acidsBasic residuesAcidic residuesPolar residuesHydrophobic residuesBoman index
ACP1EK1C196H317N43O64SCGHPRW4,08527,78613
ACP2EK1PC196H317N43O64SCGHPRW4,08527,78613
ACP3EK1CC196H317N43O64SCGHPRW4,08527,78613
ACP4EK1C1C196H317N43O64SCGHPRW4,08527,78613
ACP5EK1C2C203H328N46O68SCHPRW4,08525,64913
ACP6EK1C3C203H328N46O68SCHPRW4,08525,64913
ACP7EK1C4C208H336N48O71SCHPRW4,08524,391113
ACP8EK1C5C208H336N48O71SCHPRW4,08524,391113
ACP9EK1C6C208H336N48O71SCHPRW4,08524,391113
ACP10EK1C7C208H336N48O71SCHPRW4,08524,391113
ACP11SARS-CoV-2-S(11681203)C172H292N48O61CFHMPTWY3,96319,44915
ACP12MBD-4 (11-40), P9C144H227N47O35S5DELMSY9,1960129
ACP13SARS-CoV-S (1151-1185), SR9, SARS-CoV-2-S (1169-1203), IPB01C168H287N47O58CFHMPTWY4,1317,14915
ACP14ATN-161C21H32N8O8SADEFGIKLMQRTVWY7,361030
ACP15AHB1C426H695N133O147S2CIPW4,621928,24825
ACP16AHB2C399H633N109O128S3CP4,251329,33728
ACP17LCB1C301H485N79O94S3CNPT4,291028,57620
ACP18LCB3C346H556N90O106S2CGPW4,681325724
ACP19MBD-4 (11-40) / P9 [H21R,K23R,K28R], P9RC144H232N52O35S5DEHKLMSY10,5160129
ACP20SARS-CoV-2-S (1169-1203)-K, IPB02C174H299N49O59CFHMPTWY4,39416,67915
ACP21SARS-CoV-2-S (1172-1205), IPB03C165H283N47O56CFHMPTWY4,39417,65814
ACP22SARS-CoV-2-S (1175-1205), IPB04C152H261N43O52CFHMPTWY4,39419,35712
ACP23SARS-CoV-2-S (1179-1205), IPB05C135H232N38O46CFHMPTWY4,39422,22510
ACP24SARS-CoV-2-S (1183-1205), IPB06C113H194N32O39CFHMPTWY4,26321,7459
ACP25SARS-CoV-2-S (1179-1211), IPB07C175H288N46O57CFHMPTW4,48521,21711
ACP26SARS-CoV-2-S (1169-1198)-K, IPB08C148H257N43O49CFHMPTWY6,65412,9913
ACP27SARS-CoV-2-S (1175-1198)-K, IPB09C124H216N36O41CFGHMPTWY6,65416610
ACP28[SARS HRC-PEG4]2-cholC374H630N108O137S2FHMPTWY3,93616,673030
ACP29MERS-CoV-HR2P-GSGSGCC200H331N49O69S2FHPRW3,95211,91714
ACP30EK1-GSGSGCC211H341N49O72S2HPRW4,08523,811213
ACP31CMKC23H47N11O5ACDEFGHILMNPQSTWY12,523001
ACP32ACE2 (27-41)C94H129N21O29CGIMPRSVW4,122536
ACP33ACE2 (37-42)C38H51N7O13ACGHIKMNPRSTVW3,55033,3312
ACP34Alisporivir, Debio-025C11H5N3O-4CDEFGHIKLMNPQRSTWY6,110003
ACP1EK1C196H317N43O64SCGHPRW4,08527,78613
ACP2EK1PC196H317N43O64SCGHPRW4,08527,78613
ACP3EK1CC196H317N43O64SCGHPRW4,08527,78613
ACP4EK1C1C196H317N43O64SCGHPRW4,08527,78613
ACP5EK1C2C203H328N46O68SCHPRW4,08525,64913
ACP6EK1C3C203H328N46O68SCHPRW4,08525,64913
ACP7EK1C4C208H336N48O71SCHPRW4,08524,391113
ACP8EK1C5C208H336N48O71SCHPRW4,08524,391113
ACP9EK1C6C208H336N48O71SCHPRW4,08524,391113
ACP10EK1C7C208H336N48O71SCHPRW4,08524,391113
ACP11SARS-CoV-2-S(11681203)C172H292N48O61CFHMPTWY3,96319,44915
ACP12MBD-4 (11-40), P9C144H227N47O35S5DELMSY9,1960129
ACP13SARS-CoV-S (1151-1185), SR9, SARS-CoV-2-S (1169-1203), IPB01C168H287N47O58CFHMPTWY4,1317,14915
ACP14ATN-161C21H32N8O8SADEFGIKLMQRTVWY7,361030
ACP15AHB1C426H695N133O147S2CIPW4,621928,24825
ACP16AHB2C399H633N109O128S3CP4,251329,33728
ACP17LCB1C301H485N79O94S3CNPT4,291028,57620
ACP18LCB3C346H556N90O106S2CGPW4,681325724
ACP19MBD-4 (11-40) / P9 [H21R,K23R,K28R], P9RC144H232N52O35S5DEHKLMSY10,5160129
ACP20SARS-CoV-2-S (1169-1203)-K, IPB02C174H299N49O59CFHMPTWY4,39416,67915
ACP21SARS-CoV-2-S (1172-1205), IPB03C165H283N47O56CFHMPTWY4,39417,65814
ACP22SARS-CoV-2-S (1175-1205), IPB04C152H261N43O52CFHMPTWY4,39419,35712
ACP23SARS-CoV-2-S (1179-1205), IPB05C135H232N38O46CFHMPTWY4,39422,22510
ACP24SARS-CoV-2-S (1183-1205), IPB06C113H194N32O39CFHMPTWY4,26321,7459
ACP25SARS-CoV-2-S (1179-1211), IPB07C175H288N46O57CFHMPTW4,48521,21711
ACP26SARS-CoV-2-S (1169-1198)-K, IPB08C148H257N43O49CFHMPTWY6,65412,9913
ACP27SARS-CoV-2-S (1175-1198)-K, IPB09C124H216N36O41CFGHMPTWY6,65416610
ACP28[SARS HRC-PEG4]2-cholC374H630N108O137S2FHMPTWY3,93616,673030
ACP29MERS-CoV-HR2P-GSGSGCC200H331N49O69S2FHPRW3,95211,91714
ACP30EK1-GSGSGCC211H341N49O72S2HPRW4,08523,811213
ACP31CMKC23H47N11O5ACDEFGHILMNPQSTWY12,523001
ACP32ACE2 (27-41)C94H129N21O29CGIMPRSVW4,122536
ACP33ACE2 (37-42)C38H51N7O13ACGHIKMNPRSTVW3,55033,3312
ACP34Alisporivir, Debio-025C11H5N3O-4CDEFGHIKLMNPQRSTWY6,110003

Literature Data

DataBase Content
Peptide IDPeptide nameSequenceTitleAuthorsJournalPMID
ACP1EK1SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELFusion mechanism of 2019-nCoV and fusion inhibitors targeting HR1 domain in spike protein.Xia S, Zhu Y, Liu M, Lan Q, Xu W, Wu Y, Ying T, Liu S, Shi Z, Jiang S, Lu LCell Mol Immunol, 2020https://pubmed.ncbi.nlm.nih.gov/32047258/
ACP2EK1PSLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELInhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion.Xia S, Liu M, Wang C, Xu W, Lan Q, Feng S, Qi F, Bao L, Du L, Liu S, Qin C, Sun F, Shi Z, Zhu Y, Jiang S, Lu LCell Res, 2020, 30, 343-355https://pubmed.ncbi.nlm.nih.gov/32231345/
ACP11SARS-CoV-2-S(11681203)DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELA pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike.Xia S, et al.Sci Adv, 2019, 5, eaav4580https://pubmed.ncbi.nlm.nih.gov/30989115/
ACP12MBD-4 (11-40), P9NGAICWGPCPTAFRQIGNCGHFKVRCCKIRA novel peptide with potent and broad-spectrum antiviral activities against multiple respiratory viruses.Zhao H, et al.Sci Rep, 2016, 6, 22008https://pubmed.ncbi.nlm.nih.gov/26911565/
ACP13SARS-CoV-S (1151-1185), SR9, SARS-CoV-2-S (1169-1203), IPB01ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELDesign of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity.Zhu Y, Yu D, Yan H, Chong H, He YJ Virol, 2020, 94, e00635-20https://pubmed.ncbi.nlm.nih.gov/32376627/
ACP14ATN-161PHSCNThe Integrin Binding Peptide, ATN-161, as a Novel Therapy for SARS-CoV-2 Infection.Beddingfield BJ, Iwanaga N, Chapagain PP, Zheng WQ, Roy CJ, Hu TY, Kolls JK, Bix GJJACC Basic Transl Sci, 2021, 6, 1-8https://pubmed.ncbi.nlm.nih.gov/33102950/
ACP15AHB1DEDLEELERLYRKAEEVAKEAKDASRRGDDERAKEQMERAMRLFDQVFELAQELQEKQTDGNRQKATHLDKAVKEAADELYQRVRDe novo design of picomolar SARS-CoV-2 miniprotein inhibitors.Cao L, Goreshnik I, Coventry B, Case JB, Miller L, Kozodoy L, Chen RE, Carter L, Walls AC, Park YJ, Strauch EM, Stewart L, Diamond MS, Veesler D, Baker DScience, 2020, 370, 426-431https://pubmed.ncbi.nlm.nih.gov/32907861/
ACP19MBD-4 (11-40) / P9 [H21R,K23R,K28R], P9RNGAICWGPCPTAFRQIGNCGRFRVRCCRIRA broad-spectrum virus- and host-targeting peptide against respiratory viruses including influenza virus and SARS-CoV-2.Zhao H, To KKW, Sze KH, Yung TT, Bian M, Lam H, Yeung ML, Li C, Chu H, Yuen KYNat Commun, 2020, 11, 4252https://pubmed.ncbi.nlm.nih.gov/32843628/
ACP28[SARS HRC-PEG4]2-cholDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGSGSGCDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGSGSGCIntranasal fusion inhibitory lipopeptide prevents direct contact SARS-CoV-2 transmission in ferretsde Vries RD, Schmitz KS, Bovier FT, Noack D, Haagmans BL, Biswas S, Rockx B, Gellman SH, Alabi CA, de Swart RL, Moscona A, Porotto MbioRxiv, 2020, doi.org/10.1101/2020.11.04.361154doi.org/10.1101/2020.11.04.361154
ACP29MERS-CoV-HR2P-GSGSGCSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGSGSGCInhibition of Coronavirus Entry In Vitro and Ex Vivo by a Lipid-Conjugated Peptide Derived from the SARS-CoV-2 Spike Glycoprotein HRC Domain.Outlaw VK, Bovier FT, Mears MC, Cajimat MN, Zhu Y, Lin MJ, Addetia A, Lieberman NAP, Peddu V, Xie X, Shi PY, Greninger AL, Gellman SH, Bente DA, Moscona A, Porotto MMBio, 2020, 11, e01935-20https://pubmed.ncbi.nlm.nih.gov/33082259/
ACP31CMKRVKRFurin Inhibitors Block SARS-CoV-2 Spike Protein Cleavage to Suppress Virus Production and Cytopathic Effects.Cheng YW, Chao TL, Li CL, Chiu MF, Kao HC, Wang SH, Pang YH, Lin CH, Tsai YM, Lee WH, Tao MH, Ho TC, Wu PY, Jang LT, Chen PJ, Chang SY, Yeh SHCell Rep, 2020, 33, 108254https://pubmed.ncbi.nlm.nih.gov/33007239/
ACP32ACE2 (27-41)TFLDKFNHEAEDLFYQRationally Designed ACE2-Derived Peptides Inhibit SARS-CoV-2.Larue RC, Xing E, Kenney AD, Zhang Y, Tuazon JA, Li J, Yount JS, Li PK, Sharma ABioconjug Chem, 2021, 32, 215-223https://pubmed.ncbi.nlm.nih.gov/33356169/
ACP34Alisporivir, Debio-025XXXVXAAXXXXInhibition of SARS-CoV-2 Infection by the Cyclophilin Inhibitor Alisporivir (Debio 025).Softic L, Brillet R, Berry F, Ahnou N, Nevers Q, Morin-Dewaele M, Hamadat S, Bruscella P, Fourati S, Pawlotsky JM, Ahmed-Belkacem AAntimicrob Agents Chemother, 2020, 64, e00876-20https://pubmed.ncbi.nlm.nih.gov/32376613/
ASCNP1SARSWW-IMWKTPTLKYFGGFNFSQIInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP2SARSWW-IIATAGWTFGAGAALQIPFAMQMAYInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP3SARSWW-IIIGYHLMSFPQAAPHGVVFLHVTWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP4SARSWW-IVGVFVFNGTSWFITQRNFFSInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP5SARSWW-VaNEVAKNLNESLIDLQELGKYEQYIKWPWYVWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP6SARSWW-VbAACEVAKNLNESLIDLQELGKYEQYIKWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP7N46QKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP8N46egQNQSANQFQKEISQINEVLTTTNTSLGKLQDDVNQNNQSLNTLQKEIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP9EPL5KKKKYRNIRRPGIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP10SR9EK13ISGINASVVNIQEEIKKLNEEAKKLNESLIDLQELIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP11SR9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP12SR9EK1IEEINKKVEEIQKKIEELNKKAEELNKKLEELQKKDesign, synthesis and screening of antisense peptide based combinatorial peptide libraries towards an aromatic region of SARS-CoV.Huang Y, Zhao R, Luo J, Xiong S, Shangguan D, Zhang H, Liu G, Chen Y.J Mol Recognit. 2008https://pubmed.ncbi.nlm.nih.gov/18383098/
ASCNP13peptide 9626TLKPIFKLPLGINITNFRHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/588
ASCNP14HR2ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/589
ASCNP15HR1-aYENQKQIANQFNKAISQIQESLTTTSTAHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/590
ASCNP16GST-removed HR2DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIIdentification of a new region of SARS-CoV S protein critical for viral entry.Guo Y, Tisoncik J, McReynolds S, Farzan M, Prabhakar BS, Gallagher T, Rong L, Caffrey M.J Mol Biol. 2009https://pubmed.ncbi.nlm.nih.gov/19853613/
ASCNP17HR1-bIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP18His6-HR1YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP19K10DLKGKYVQIPFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP2SARSWW-IIATAGWTFGAGAALQIPFAMQMAYInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP3SARSWW-IIIGYHLMSFPQAAPHGVVFLHVTWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP4SARSWW-IVGVFVFNGTSWFITQRNFFSInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP5SARSWW-VaNEVAKNLNESLIDLQELGKYEQYIKWPWYVWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP6SARSWW-VbAACEVAKNLNESLIDLQELGKYEQYIKWInhibition of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) infectivity by peptides analogous to the viral spike protein.Sainz B Jr, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, Garry RF.Virus Res. 2006https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP7N46QKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP8N46egQNQSANQFQKEISQINEVLTTTNTSLGKLQDDVNQNNQSLNTLQKEIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP9EPL5KKKKYRNIRRPGIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP10SR9EK13ISGINASVVNIQEEIKKLNEEAKKLNESLIDLQELIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP11SR9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELIdentification of a minimal peptide derived from heptad repeat (HR) 2 of spike protein of SARS-CoV and combination of HR1-derived peptides as fusion inhibitors.Liu IJ, Kao CL, Hsieh SC, Wey MT, Kan LS, Wang WK.Antiviral Res. 2009https://pubmed.ncbi.nlm.nih.gov/18983873/
ASCNP12SR9EK1IEEINKKVEEIQKKIEELNKKAEELNKKLEELQKKDesign, synthesis and screening of antisense peptide based combinatorial peptide libraries towards an aromatic region of SARS-CoV.Huang Y, Zhao R, Luo J, Xiong S, Shangguan D, Zhang H, Liu G, Chen Y.J Mol Recognit. 2008https://pubmed.ncbi.nlm.nih.gov/18383098/
ASCNP13peptide 9626TLKPIFKLPLGINITNFRHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/588
ASCNP14HR2ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/589
ASCNP15HR1-aYENQKQIANQFNKAISQIQESLTTTSTAHeptad repeat-derived peptides block protease-mediated direct entry from the cell surface of severe acute respiratory syndrome coronavirus but not entry via the endosomal pathway.Ujike M, Nishikawa H, Otaka A, Yamamoto N, Yamamoto N, Matsuoka M, Kodama E, Fujii N, Taguchi F.J Virol. 2008https://jvi.asm.org/content/82/1/590
ASCNP16GST-removed HR2DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIIdentification of a new region of SARS-CoV S protein critical for viral entry.Guo Y, Tisoncik J, McReynolds S, Farzan M, Prabhakar BS, Gallagher T, Rong L, Caffrey M.J Mol Biol. 2009https://pubmed.ncbi.nlm.nih.gov/19853613/
ASCNP17HR1-bIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP18His6-HR1YENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP19K10DLKGKYVQIPFusion core structure of the severe acute respiratory syndrome coronavirus (SARS-CoV): in search of potent SARS-CoV entry inhibitors.Chu LH, Chan SH, Tsai SN, Wang Y, Cheng CH, Wong KB, Waye MM, Ngai SM.J Cell Biochem. 2008https://pubmed.ncbi.nlm.nih.gov/18442051/
ASCNP20K20NCVKMLCTHTGTGQAITVTPShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP21K8PTTCANDPShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP22P9CANLLLQYGSFCTQLNRALSGIAShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP23P8PSSKRFQPFQQFGRDVSDFTShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP24P10RNTREVFAQVKQMYKTPTLKYFGShort peptides derived from the interaction domain of SARS coronavirus nonstructural protein nsp10 can suppress the 2-O-methyltransferase activity of nsp10/nsp16 complex.Ke M, Chen Y, Wu A, Sun Y, Su C, Wu H, Jin X, Tao J, Wang Y, Ma X, Pan JA, Guo D.Virus Res. 2012https://pubmed.ncbi.nlm.nih.gov/22659295/
ASCNP25P6TKFPSVYAWERKKISNCVADSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP26P5KGIYQTSNFRVVPSGDVVRFSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP27P2KSNVVRGWVFGSTMNNKSQSSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP28P4TDAVDCSQNPLAELKCSVKSFSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP29P1TSSMRGVYYPDEIFRSDTLYLSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP30P3YKGYQPIDVVRDLPSGFNTLSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP31P7YNYKYRYLRHGKLRPFERDISynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP32HR2-1VYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP33HR2-2QPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQSynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP34HR2-3SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNESynthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.Lu W, Wu XD, Shi MD, Yang RF, He YY, Bian C, Shi TL, Yang S, Zhu XL, Jiang WH, Li YX, Yan LC, Ji YY, Lin Y, Lin GM, Tian L, Wang J, Wang HX, Xie YH, Pei G, Wu JR, Sun B.FEBS Lett. 2005https://pubmed.ncbi.nlm.nih.gov/15811330/
ASCNP35HR2-4LDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP36HR2-5FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP37HR2-6PDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP38HR2-7GDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP39HR2-8ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP40HR2-9ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP41HR2-10ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP42HR2-11GINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP43HR2-12INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP44HR2-13INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYISuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP45HR2-14INASVVNIQKEIDRLNEVAKNLNESLIDLQELGKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP46HR2-15INASVVNIQKEIDRLNEVAKNLNESLIDLSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP47HR2-16VVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP48HR2-17VVNIQKEIDRLNEVAKNLNESLIDLQELGKSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP49HR2-19IQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP50HR2-20IDRLNEVAKNLNESLIDLQELGKYEQYIKWPWSuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP51sHR2-1LDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP52sHR2-2PKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP53sHR2-3LDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESuppression of SARS-CoV entry by peptides corresponding to heptad regions on spike glycoprotein.Yuan K, Yi L, Chen J, Qu X, Qing T, Rao X, Jiang P, Hu J, Xiong Z, Nie Y, Shi X, Wang W, Ling C, Yin X, Fan K, Lai L, Ding M, Deng H.Biochem Biophys Res Commun. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP54sHR2-4FKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP55sHR2-5TSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP56sHR2-6VDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP57sHR2-7DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP58sHR2-8ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP59sHR2-9ELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP60sHR2-10ELDSPKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP61mHR2DLSLDFEKLNVTLLDLTYEMNRIQDAIKKLNESYINLKESevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP62sHR1AYRFNGIQVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP63sHR1cNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP64NP-1GVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP65NP-2LTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP66NP-3KQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGSevere acute respiratory syndrome coronavirus (SARS-CoV) infection inhibition using spike protein heptad repeat-derived peptides.Bosch BJ, Martina BE, Van Der Zee R, Lepault J, Haijema BJ, Versluis C, Heck AJ, De Groot R, Osterhaus AD, Rottier PJ.Proc Natl Acad Sci U S A. 2004https://pubmed.ncbi.nlm.nih.gov/15184046/
ASCNP67NP-4GRLQSLQTYVTQQLIRAAEIRASANLAATKMSECInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP68CP-1GINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP69CP-2KEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP70MucroporinLFGLIPSLIGGLVSAFKInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP71Mucroporin-M1LFRLIKSLIKRLVSAFKInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP72Mucroporin-S1SLIGGLVSAFKInteraction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification of fusion inhibitors.Liu S, Xiao G, Chen Y, He Y, Niu J, Escalante CR, Xiong H, Farmar J, Debnath AK, Tien P, Jiang S.Lancet. 2004https://pubmed.ncbi.nlm.nih.gov/15043961/
ASCNP73Mucroporin-S2VSAFKVirucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses.Li Q, Zhao Z, Zhou D, Chen Y, Hong W, Cao L, Yang J, Zhang Y, Shi W, Cao Z, Wu Y, Yan H, Li W.Peptides. 2011https://pubmed.ncbi.nlm.nih.gov/21620914/
ASCNP74SEQ ID NO:1FKLPLGINITNFRAILTAFSVirucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses.Li Q, Zhao Z, Zhou D, Chen Y, Hong W, Cao L, Yang J, Zhang Y, Shi W, Cao Z, Wu Y, Yan H, Li W.Peptides. 2011https://pubmed.ncbi.nlm.nih.gov/21620914/
ASCNP75SEQ ID NO:2PTTFMLKYDENGTITDAVDCVirucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses.Li Q, Zhao Z, Zhou D, Chen Y, Hong W, Cao L, Yang J, Zhang Y, Shi W, Cao Z, Wu Y, Yan H, Li W.Peptides. 2011https://pubmed.ncbi.nlm.nih.gov/21620914/
ASCNP76SEQ ID NO:3VLYNSTFFSTFKCYGVSATKVirucidal activity of a scorpion venom peptide variant mucroporin-M1 against measles, SARS-CoV and influenza H5N1 viruses.Li Q, Zhao Z, Zhou D, Chen Y, Hong W, Cao L, Yang J, Zhang Y, Shi W, Cao Z, Wu Y, Yan H, Li W.Peptides. 2011https://pubmed.ncbi.nlm.nih.gov/21620914/
ASCNP77SEQ ID NO:4PALNCYWPLNDYGFYTTSGISynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61522
ASCNP78SEQ ID NO:5RDVSDFTDSVRDPKTSEILDSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61523
ASCNP79SEQ ID NO:6YQDVNCTDVSTAIHADQLTPSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61524
ASCNP80SEQ ID NO:7SNNTIAIPTNFSISITTEVMSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61525
ASCNP81SEQ ID NO:8QYGSFCTQLNRALSGIAAEQSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61526
ASCNP82SEQ ID NO:9GIGVTQNVLYENQKQIANQFSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61527
ASCNP83SEQ ID NO:10IQKEIDRLNEVAKNLNESLISynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61528
ASCNP84MHVWW-IVGYFVQDDGEWKFTGSSYYYSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61529
ASCNP85HR2LSIPNFGSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELGNYSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61530
ASCNP86HR2PSLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKELSynthetic peptide targeting critical sites on the SARS-associated coronavirus spike protein responsible for viral infection and method of use thereofBojian, Yi, Jiandong, Ming-LiangThe University of Hong Knog, (CN)https://hub.hku.hk/handle/10722/61531
ASCNP87HR2P-M1SLTQINTTLLDLEYEMRSLQQVVKALNESYIDLKELInhibition of severe acute respiratory syndrome-associated coronavirus(SARS-CoV) infectivity by peptides analogous to the viral spike proteinSainz B, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, et alVirusRes 2006;120(1-2):14655https://pubmed.ncbi.nlm.nih.gov/16616792/
ASCNP88HR2P-M2SLTQINTTLLDLEYEMKKLEEVVKKLEESYIDLKELStructure-based discovery ofMiddle East Respiratory Syndrome Coronavirus fusion inhibitor.Sainz B, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, et alVirusRes 2006;120(1-2):14656https://pubmed.ncbi.nlm.nih.gov/24473083/
ASCNP89HHVTTTFAPPPPRStructure-based discovery ofMiddle East Respiratory Syndrome Coronavirus fusion inhibitor.Sainz B, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, et alVirusRes 2006;120(1-2):14657https://pubmed.ncbi.nlm.nih.gov/24473083/
ASCNP90SSVVPSKATWGFAStructure-based discovery ofMiddle East Respiratory Syndrome Coronavirus fusion inhibitor.Sainz B, Mossel EC, Gallaher WR, Wimley WC, Peters CJ, Wilson RB, et alVirusRes 2006;120(1-2):14658https://pubmed.ncbi.nlm.nih.gov/24473083/
ASCNP91MelittinGIGAVLKVLTTGLPALISWIKRKRQQProtec-tive effect of intranasal regimens containing peptidic Middle East RespiratorySyndrome Coronavirus fusion inhibitor against MERS-CoV InfectionChannappanavar R, Lu L, Xia S, Du L, Meyerholz DK, Perlman S, et alJ InfectDis 2015;212(12):1894903.https://pubmed.ncbi.nlm.nih.gov/26164863/
ASCNP92UruminIPLRGAFINGRWDSQCHRFSNGAIACAPhage displayed peptides recognizing porcineaminopeptidase N inhibit transmissible gastroenteritis coronavirus infectionin vitroRen X, Liu B, Yin J, Zhang H, Li GVirology 2011;410(2):299306https://pubmed.ncbi.nlm.nih.gov/21176936/
ASCNP93NYADITFXDLLXYYGPPhage displayed peptides recognizing porcineaminopeptidase N inhibit transmissible gastroenteritis coronavirus infectionin vitroRen X, Liu B, Yin J, Zhang H, Li GVirology 2011;410(2):299307https://pubmed.ncbi.nlm.nih.gov/21176936/
ASCNP94G1LRSRTKIIRIRHThe catalytic subunit of the SWR1 remodeler is a histone chaperone for the H2A.Z-H2B dimerHong J, et al. (2014)Mol Cell53(3):498-505https://www.yeastgenome.org/reference/S000156974
ASCNP95G2MPRRRRIRRRQKAn Amphibian Host Defense Peptide Is Virucidal for Human H1 Hemagglutinin-Bearing Influenza VirusesDavid J Holthausen1,Song Hee Lee1,Vineeth Tv Kumar2,Nicole M Bouvier3,Florian Krammer3,Ali H Ellebedy1,Jens Wrammert1,Anice C Lowen1,Sanil George2,Madhavan Radhakrishna Pillai2,Joshy JacobImmunity 2017 Apr 18;46(4):587-595.https://pubmed.ncbi.nlm.nih.gov/28423338/
ASCNP96Latarcin 1SMWSGMWRRKLKKLRNALKKKLKGESpn1 regulates the recruitment of Spt6 and the Swi/Snf complex during transcriptional activation by RNA polymerase IIZhang L, et al. (2008)Mol Cell Biol28(4):1393-403https://www.yeastgenome.org/reference/S000125985
ASCNP97Epinecidin 1GFIFHIIKGLFHAGKMIHGLVPHYTOCHEMICAL CONSTITUENTS AND ANTIMICROBIAL ACTIVITIES OF THE ROOT BARK EXTRACTS OF Massularia acuminata sppU. S. Ukekpe1,2,*, H. M. Adamu2 , E.O. Ekanem2 and A. A. Saleh3International Journal of Advanced Research (IJAR)http://www.journalijar.com/article/5741/phytochemical-constituents-and-antimicrobial-activities-of-the-root-bark-extracts-of-massularia-acuminata-spp./
ASCNP98Cecropin AKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAKPHYTOCHEMICAL CONSTITUENTS AND ANTIMICROBIAL ACTIVITIES OF THE ROOT BARK EXTRACTS OF Massularia acuminata sppU. S. Ukekpe1,2,*, H. M. Adamu2 , E.O. Ekanem2 and A. A. Saleh4International Journal of Advanced Research (IJAR)http://www.journalijar.com/article/5741/phytochemical-constituents-and-antimicrobial-activities-of-the-root-bark-extracts-of-massularia-acuminata-spp./
ASCNP99HBD-2, 3LKKLCKLLKKLCKLAGIdentification of crucial yeast inhibitors in bio-ethanol and improvement of fermentation at high pH and high total solidsHuang H, et al. (2011)Bioresour Technolhttps://www.yeastgenome.org/reference/S000145571
ASCNP100Hp1036ILGKIWEGIKSIFVirocidal activity of Egyptian scorpion venoms against hepatitis C virus Hepatitis virusesAlaa M H El-Bitar12,Moustafa M H Sarhan3,Chie Aoki4,Yusuke Takahara5,Mari Komoto6,Lin Deng7,Mohsen A Moustafa8,Hak Hotta9Virology Journalhttps://pubmed.ncbi.nlm.nih.gov/25889296/
ASCNP101Hp1239ILSYLWNGIKSIFVirocidal activity of Egyptian scorpion venoms against hepatitis C virus Hepatitis virusesAlaa M H El-Bitar12,Moustafa M H Sarhan3,Chie Aoki4,Yusuke Takahara5,Mari Komoto6,Lin Deng7,Mohsen A Moustafa8,Hak Hotta9Virology Journalhttps://pubmed.ncbi.nlm.nih.gov/25889296/
ASCNP102IndolicidinILPWKWPWWPWRRSources of plastic marine debris on beaches of Korea: More from the ocean than the landYong Chang Jang, Jongmyoung Lee, Sunwook Hong, Jong Su Lee, Won Joon Shim & Young Kyoung Song Ocean Science Journalhttps://link.springer.com/article/10.1007/s12601-014-0015-8
ASCNP103caerin 1.10GLLSVLGSVAKHVLPHVVPVIAEKLThe catalytic subunit of the SWR1 remodeler is a histone chaperone for the H2A.Z-H2B dimerHong J, et alMol Cellhttps://www.yeastgenome.org/reference/S000156975
ASCNP104caerin 1.6GLFSVLGAVAKHVLPHVVPVIAEKLModulation of the induction or expression of psychostimulant sensitization by the circumstances surrounding drug administrationT E Robinson 1, K E Browman, H S Crombag, A BadianiNeurosci Biobehav Revhttps://pubmed.ncbi.nlm.nih.gov/9579324/